best trisomy data

Best data:

NP_001273759.1
RCC1 and BTB domain-containing protein 2 isoform 1 [Homo sapiens] >ref|XP_003811475.1| PREDICTED: RCC1 and BTB domain-containing protein 2 isoform 2 | unnamed protein product [Homo sapiens]
Gene info linked to NP_001273759.1Genome view with mapviewer linked to NP_001273759.1
BAG51149.1
unnamed protein product [Homo sapiens]
Gene info linked to BAG51149.1
XP_001318506.1
hypothetical protein [Trichomonas vaginalis G3] >gb|EAY06283.1| hypothetical protein TVAG_475170 [Trichomonas vaginalis G3]
Gene info linked to XP_001318506.1
EAX08800.1
regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2, isoform CRA_b [Homo sapiens]

Advertisements

Favorite genome end user methods and people

For the genome end user, I recommend

Daniela Evangelista.

What a powerhouse of talent. Superb.

More creative juices than a week of summer on a beach.!

WOW!

OK,
So the genome end user is wishing for oncogene specific’s?

here is the frame derived for meiosarcoma.

L……K….Q….A……K…..N….N….E….L

Retrospective cobalt frame to oncogene specific residue.

*test your residue for challenge in alignment.
*proposed useful towards Harvard large set.

May provide therapeutic avenue.
M.

I cannot resist:
you waited:…..perhaps.

The premise of oocyte external valene determinant upon cell spindle conformational chemistry in trisomy at index case presentation.
by Mark McGary 6/2/14

The valene stack method as a conditional assay in species protein residue has produced exceptional assay fundamental in chromosome of homo sapiens. As a model, it was origined in the CNS gene elements of tissue.
The regard for index case in trisomy, an underlying concern. However, the case presentation as stastastically regarded, demonstrates a certain intersection in protein residue to be adequately modeled. Provision of single point mutation, SNP, mechanism one by one or in the wider sense of chromosomal base (ORF) as intersection lends itself as model, to underlying algorythmic process as blast result. The model conditioned as valene selected, premised to produce trisomy as outcome. An outcome to mutation adventure induced by pathogen residue in a wide assortment or narrow, as the alignments are observed.. I cite the pox virus in insult to reptile as an example. Tryponosome s, limited to the gut of ruminant, appears as a motief within the pox residue, suggesting a cross species insult at predation. (unpublished data).
The models of typicial end user, do not well select for small interior mechanism. This is not to say the pictographs are excellent and superb. Typical blast outcome the engine of all protein specifics. However, the nomenclature as assigned is confusing non protein. Thus, this model will rely upon the protein and molecular weight, deterministic to membrane condition and active stochastically competent model, to more determine the craft and selective regard for mutation adventure as conserved. In this modeling process, outliers are rejected easily. This is not observed within the models of 2007 as shown in non protein relief. See EMBO studies. 2005-present.
In initial model, I was quite surprised at the eucaryotic residue appearance, having expected viral origin. However, I have rather regarded viral -eucaroytic function to appear as residue specific, and exploit whatever such regards are observed in output. This relief, actual, is the model mechanism to output and observation, rather than premised insult. That is to say, observe and follow actual data.

Let us consider the intra uterine enviromental regards. Here we have the tissue and heme supply mechanism to produce a viable embryo, cell mieosis post fertilization, to term. Typically supplying all regards of protection to enable viability. In trisomy, an end process is observed impacted. Mutation adventure, conserved.
Let us grapple with the proceeding of actual trisomy as the index case, and supply effective model to deterministic endpoint. Why valene is useful is observed in the immune challenge of leishmanasis to human host. Here, I draw upon my back ground within infectious disease study to observe the fluke evasion within immune response as mechanistic. All while remembering a key issue. That maternal envelope provides immune response as latent to development in fetal form. Also, is a placental barrier not well exploited by pathogen.
As I observed initial blast determinants, I found that the blast alogrythmic envelope was specific to valene conservation within a set where alogrythm failed at 50% search particulars beyond a slender marginal alignment pathway across species. This suggest a natural limiting outcome, and is premised a superb interior view to both SNP and cognatively small impact sites in chromosome. What was of particular interest in the outcome, was that initial search positional motief regarded chromosome 4, and 21.q22 was observation up codon or yet product undescribed, and actual products were not yet conditions. Hence a regard for low number chromosome as per conditon to trisomy, with valene occurance post meiosis, impacting the developmental initial cycle, was suggested immediately. This suggests typical research method, is rather focused upon outcome, rather than index case and the origin of insult as protein derived. Hence, rather looking in the wrong protein relief suggested as initial mechanism. This with the most cursory of deep views or conditions as applied with Selkov toolbar and the valene modifications observed useful.

Let us further contrast the tral push observation as interesting and coherent to the study of trysomy. Outcomes in chrosomosome mutation adventure having developmental and age resultant pathogenesis.

Here, the goals could be premised as:
1. Continue the valene model to SNP sites and record the set.
2. contrast tral push and Valene block method to 4 site, 21q22.
3. Search for an insult model, with valene precursor as impact and mutation specific.

4. Continue the observation on T vaginalisis as having substance in impact via mole weight particulars observed.
5. Send the best data to membrane at V Cell 5.
The research proceeding for the index case in Downs Syndrome.
The premise of causality in trisomy. By Mark McGary
Having read the overview of studies, spanning a tremendous research effort….I have surmised the defect as causal to chromosome as specific to…..
The drafted gene elements of virus. I will examine this topic, first with brief overviews from within the OMIM entry #190685, assessment page.
*Authors note: Here, the view was later swayed by data to eucaroyte, but impacted also in yersina residues. Hence, indeterminate. But promising in sorting process avaiable.

Warren et al. (1987) and Sherman et al. (1991) have described an association between trisomy 21 and reduced recombination in meioses. A significant proportion (at least 30%) of maternal meiosis I nondisjunctions of chromosome 21 is associated with failure to recombine. It is not known whether the paucity of recombination is related to maternal age; moreover, the mechanism of recombination failure (asynapsis vs abnormalities during or after synapsis) is as yet unclear.
EMBO work superb, but impacted by confusing nomenclature. Huge sets of indeterminate multiple reactions. Not well defined. Premised working with post insult data. This would not well condition underlying mutation.

Why would I grapple with this viewpoint in first intersection? My largest underlying notion to assess syndrome?
Having described the draft element of HIV 1. I would premise a similar conditon towards causal prophensity.

Mapping of the chromosomal region that, if triplicated, results in the phenotypic characteristics of Down syndrome has been facilitated by the use of DNA samples from individuals who have partial trisomy 21 with or without features of the Down syndrome phenotype (Rahmani et al., 1989; 2529205] [Full Text: Elsevier Science]” class=”sectionJump entry-reference” sectionid=”reference49″McCormick et al., 1989; 2143053]” class=”sectionJump entry-reference” sectionid=”reference38″Korenberg et al., 1990; 8055322]” class=”sectionJump entry-reference” sectionid=”reference19″Delabar et al., 1993; Korenberg, 1993). Although detailed analysis of these DNAs is still under way, an area of approximately 5 Mb between loci D21S58 and D21S42 has been identified that is associated with mental retardation and most of the facial features of the syndrome. In particular, a subregion that includes D21S55 and MX1 (interferon-induced protein p78; 147150), the latter being located in band 21q22.3, has been associated with mental retardation and several morphologic features, including oblique eye fissure, epicanthus, flat nasal bridge, protruding tongue, short broad hands, clinodactyly of the fifth finger, gap between first and second toes, hypotonia, short stature, Brushfield spots, and characteristic dermatoglyphics (8055322]” class=”sectionJump entry-reference” sectionid=”reference19″Delabar et al., 1993). Additional phenotypic characteristics may map outside the minimum critical region (symbolized DCR). Material from other rare patients who have features of Down syndrome but no visible chromosomal abnormality may help to narrow down the critical region. In several such studies, however, no triplicated region has been identified (2529205] [Full Text: Elsevier Science]” class=”sectionJump entry-reference” sectionid=”reference49″McCormick et al., 1989; Delabar et al., 1993). It is possible that these patients do not have any chromosome 21 abnormality and their phenotype is a phenocopy of Down syndrome.
after birth. TMD is characterized by an abundance of blasts within peripheral blood and liver, and undergoes spontaneous remission in a majority of cases. TMD may be a precursor to AMKL, with an estimated 30% of TMD patients developing AMKL within 3 years. Mutations in GATA1 are associated with AMKL of Down syndrome. To determine whether the acquisition of GATA1 mutations is a late event restricted to acute leukemia, 12560215] [Full Text: HighWire Press]” class=”sectionJump entry-reference” sectionid=”reference54″Mundschau et al. (2003) analyzed GATA1 in DNA from TMD patients. They found that GATA1 was mutated in the TMD blasts from every infant examined. These results demonstrated that GATA1 is likely to play a critical role in the etiology of TMD, and mutagenesis of GATA1 represents a very early event in myeloid leukemogenesis in Down syndrome. 12586620] [Full Text: HighWire Press]” class=”sectionJump entry-reference” sectionid=”reference33″Hitzler et al. (2003) likewise presented evidence that GATA1 mutations are an early event, and that AMKL arises from latent transient leukemia clones following initial apparent remission. All 7 patients reported by 12560215] [Full Text: HighWire Press]” class=”sectionJump entry-reference” sectionid=”reference54″Mundschau et al. (2003) and almost all of the patients studied by 12586620] [Full Text: HighWire Press]” class=”sectionJump entry-reference” sectionid=”reference33″Hitzler et al. (2003) had deletions or insertions in the GATA1 gene rather than nucleotide substitutions.

12200707] [Full Text: Nature Publishing Group]” class=”sectionJump entry-reference” sectionid=”reference80″Taketani et al. (2002) screened the RUNX1 gene (151385) in 46 Down syndrome patients with hematologic malignancies. They identified a heterozygous missense mutation (H58N; 151385.0008) in 1 patient diagnosed with TMD 5 days after birth. The patient died suddenly 12 months after birth; it was not known whether she developed acute myeloid leukemia.
Here, I confess to having not well noted the source: Above. I hope the interested reader will forive that omission and I will review my notes. Adapting to the internal references cited within the text.
This page is actual research notation, and I hope the research and review inquiry to disease will forgive my oversight if I fail to mention every particular. In typical end use, the data is origined at NIH, NCBI. Chromosome data via OMIM.site.
Here, the coherent observation implied by myeloid descriptors above….should be contrasted with the Tralpush observations available.

Let us examine the viral assignment of residue in HIV -1 as a graphical model. *Viral residues sourced via VIPR, IRD. HIV glycoprotein source. NCBI, NIH

The observation of HIV -1 draft mosaic comes as the residue specifics of homo sapiens, with corresponding blast output….as shown with addative HIV residue…to blast align with the viral residue set. Hiv latency, demonstrated in one model as ocular and CNS site specific, also has interesting interaction with cis and trans affinity to that locus as residue assay proceeds.
Here, I premise a similar mechanism causal to the chromosomal mutation adventure, observed in c21q22.1, 23. Observe the variant other abberant forms and site locus to premise corespondance to my premised mechanism. In fact, a typical post insult viral prophensity. See the Nile crocidile pox virus at insult to crocidilla for an interspecies example.
Multiple studies, have engaged the murine model to demonstrate alteration…… However, I premise skewed results in that small but vital pathway in mouse, the sweet receptor as an exemplar, are in fact missing in the non primate model. I have become rather skeptical of proposed findings in this regard. This research habit to murine model perhaps driven by cost contraints is non determinant in some particulars……and potentially the most vital particular.
The hedgehog would be a much better selection in mammal;, with rabbit an addative species selection. This popularity of murine model driven by cost constraint I premise with sever limitation, and skewed result. Would the interested reader have every mammal challenge working and effected on a mammal lacking the homo sapiens pathways vital to research in the drug formulary applied as intra venous challenge to their own vein? I would think not.
Another strong indication of study regards, the rather high case presentation at live birth. 1 in 1000, a particular cited. Clearly, a potential for conserved mutation adventure could be postulated in population observed to potential for viral insult.
Therefore, using a particular toolbar modified to acertain v-117 non polar mole weight affinity in residue endpoint, hence to assigned reassortment, a deterministic set of output can be surmised. My task now become organ and species specific.

That data: below.

Authors note:
Preliminary data in research notebook, of first output via Selkov 117 modification.
Yet to be fully engaged. Initial sets and research topics are briefly surmised in attachments, per UDP assingment.
Alternate model of trysomy index case in mannose microphage receptor site via bacteriacemic insult pre-ovary production of oocyte.

Here, the avenue of study, shifting from the view of viral residue to mannose receptor. An excellent 1990 Harvard study described the implication in ovary. Thus, the research direction here has strong implied reproductive impact as research arm.
Interestingly, the process of elimination could be well served by clinicial trial in the modern test output and sample available. However, I consider my assay skills adequate to narrow the particulars of this interesting study.
This refinement in view now can be contrasting data as re examined for best particular protein for study. Having long engaged in research, I do feel the mannose has the right sensibility. Why.
Becase of the documentaion included in the 1990 Harvard paper.

The particulars of alignment are tremendous:
YP_003965969 —————————————————————————- ADU56613 1 [80]PALCFVVPDGYK-FTGNVLILLECFVRSSPVNFEQKYLEDYKKLEQLKGDLE—SVGINLVPLIDGRTTFYNEQI 152 XP_004716076 1 MPLPFSVKVWEQdLRGRSLIFEIRDISHSPIEQQHHLLTPPGETVHCASDLRtilSVIQYEYYLPSAQSVSRNESA 76 YP_003965969 ——————————————————————————– ADU56613 153 PDWVNDKLRDTLFALLKYSQESNALFEESEYSRLCESLALTSGRLSGIESINALIDNR–ARHFEELISCCHQGINNKLS 230 XP_004716076 77 AETLTERHPVVVESILTPEDALRSESEETWAPRALNALGPGQPLDRQTFALRRLTDTRqfLIYNEDHKRCVEVVDAGAVQ 156 YP_003965969 ——————————————————————————– ADU56613 231 AHDVKSSIEEEYQIFRNKLRQGGIESQFIKTDKVKLLEDFRNLYNDKISTHDESIEQLTFQFQRASPVLKFLYADLNSSE 310 XP_004716076 157 TAVCNPDSESQKFRWVSDYHLMSVALKLCLGVPSKTDWVKVLLYACENSKEDQKWECKNDTLFGLRGEELYFNYGNRQEK 236 YP_003965969 —————– ———————————————————— ADU56613 311 EKPVDPQNGQMQCWRSF LNKVKSLRILNTRRKLLLVFDVLILLASRLDCLEHNNKYLVGWLGSCFVSVNDRLVSLES 387 XP_004716076 237 NIMLYKGSGLWSRWKIY[8]RGYEAMFTLLGNANGATCAFPFKFENKWYADCTSAGRSDGWLWCGTTTDYDTDKLFGFCP 321 YP_003965969 ———- ——————————————————– —— ADU56613 388 TK-RDLKR-W[21]NHELLTIIN-KVLTRATNALKEVGIEIDSYGIDLKILDCDVYDTIMSIEVSGVTPT[12]YTLGVV 489 XP_004716076 322 MKfEDSERlW NKDPLTSISyQINSKSALTWHQARKSCQQQNAELLSITEVHEQTYLTGLTHALTSG LWIGLN 393 YP_003965969 —————————————————————— ———– ADU56613 490 DILNATDLERLSTLSLALINSMKTSSTVKLRQN–EFGPSRYQVVRCKEAYCQEFFVNKIGFKLLY QKTGECSKCYA 564 XP_004716076 394 SLSFNTGWQWSNRSPFRYLNWLPGSPSTEPGKScvSLNPGKNAKWENLECIQKLGYICKKGNSTLN[5]SESDVPTSCPS 475 YP_003965969 ————————————————– ————————— ADU56613 565 INNNVVGEVCSFYADPKRFFPAVFSSDVLQKVVNVMVSWIEECSELSEQL VTIKLLTKMILVLILTHPSKRCQKFLQ 641 XP_004716076 476 QWWPYAGYCYKIHRGAKKIQRDALTACRKEGGDLASIHSIEEFDFIFSQL[5]DELWIGLNDINIQMYFEWSDRTPVTFT 557 YP_003965969 ——————————————————————————– ADU56613 642 NIRYFVMAFVSDFHHKDLIDKIREDLITEVEY-LLYKLVCHLLGIILSEEVVSMMTNRFKFVLNISYMCHFITKETPDRL 720 XP_004716076 558 KWLRGEPTHENYRQEDCVVMKGKDGYWADLACeQPLDYICKMKSQSQAPEIVEVETGCRKGWKKHGFYCYLIGHTLSTFT 637 YP_003965969 1 ——— —————————————————————–ME 2 ADU56613 721 TDQIKCFEK[13]NPKDDASEEELHEMIYNARKFLSKECCADADKVRYKKPGVSKKFISLLVSSFNNGSLFKGKEVKKAL 809 XP_004716076 638 EANKTCGNE KAYLTTVEDRYEQAFLTSLVGLRPERYFWTGLSDVQSKGTFQWTIGEEVQFTHWNSDMPGRKAGCVA 713 YP_003965969 3 VDFFEQKKQETGVNLSAVQREAVE-HTEG-ALL——-VLASPGSGKTTMMIMKIGYLIEEKDVDPSRIRAVTF—- 69 ADU56613 810 LDPLITSGCATALDLASNKSVVVNKYTDG-SRVLDYDFNKLTALAVTQLTEVFARKGKYLLNKQDYDYKIQQAMSNLVLG 888 XP_004716076 714 MRTGSAGGLWEVLKCEEKVKFVCKHWAEGvTRPPEPTTTPEPRCPENWGTTSHSSLCYKLFTKGKHDKKTWFESRDFCRA 793 YP_003965969 70 SNASATDMDNRFDKLFPHLKDNKVKFSTIHSFAFEVVRAYFKKNNiRYQLIEGNMDKPNSEPCRVVNKLNKRIILRRIFR 149 ADU56613 889 SKEGSSDINNTDLDEILLDGGASEYFDHLRCTVDNIISQYRELPG-RQQQVDCSSPSISDLDKVVEEKLFIRLIKSELSN 967 XP_004716076 794 LGGDLASINHKEEQQA–IWRLITSGSNYHELFWLGLTYASPSEG–FTWSDGSPVSYEHWAFGEPNNYQNTEYCGELKG 869 YP_003965969 150 E—-VTQENVTEEQMEELLSYI—SYIKNKLIPYDQLEDI—ETSIPSASEIFLSYEEFKCADFTNRLVDYDDMLVI 219 ADU56613 968 HmiEDFDRETLPEDQYVKICESIYGDETLRDKYFYTGPMNSCpigELTKAVVTRTFLDQEYFQCFKSILLVMNGNRLMGK 1047 XP_004716076 870 D–PSMSWNDINCEHLNNWICQIKKGQTLKPEPTPAPQDNPQ——–VTADGWIIYNEQEQYYISKEKENMDNARAF 939 YP_003965969 220 ANDALEKDAGMLAEYQSMFDYFLTDESQDNSLVQNLII —EKLVRLKGNICVVADDDQSIYGWRGAAPEYLLN— 290 ADU56613 1048 YSHYKSKCLNFKFDTGKLADDVRISERESNSEALSKAL SLTNCTTAMLKNLCFYSQESPQSYNSTGPDTGRLKFSLS 1124 XP_004716076 940 CKKNFGDLASIKGESEKKFLWKYVNRNDPQSAYFIGLL[4]KKFSWMDGSKVDFVAWATGEPNFANDDENCVTMYSNSGF 1020 YP_003965969 291 FKEVYPNAKILYMVQNYRSTKDIVEV ANQFIKRNKNRYDKEMFTEKESFKPIQLSHLDTYEAQIRHIVEKVKYAP 365 ADU56613 1125 YKEQVGGNRELYIGDLRTKMFTRLIE -DYFEALTSQLTGSCLNNEKEFDNAILSMKLNVSSAHVSYSMDHSKWGP[6] 1204 XP_004716076 1021 WNDVNCGYPHAFICHRHNSSINSTAL[24]IFGFVEDERKNWHEARTACKEFKGNLVSILNEKEQAFLTYSMRGSNFDA 1119 YP_003965969 366 —VKKEVAILYRNNSSSIALIDELE———HQGIPFYI———–KDSDNKFFSHWIIEDILNFMRMSY– 420 ADU56613 1205 FLTIIQNLILLSDDLQADLKGKDYLSTLLTWHMHKMVEIPFNVVSAMMKSYIKSQLGLKKKTTQSVTEDFFNSNFQTGTV 1284 XP_004716076 1120 WIG-LNDVNSEHTFLWTNQRGVHYTNWGKGYPGGRRSSLSYEDADCVVMIGGKSRDA–GQWMDVPCDSKRGYICQAPLV 1196 YP_003965969 421 ——————SDKHPILLEKIHTKFNGYINKPQIEYLKEINNKASVFDNLLK————-LNVPVYQ 469 ADU56613 1285 PSHISSILDMGQGILHNTSDFYALISERFINFAVKCVSGGQIDAYTSSDDQISLFDQNLTQLLSRDEEEFKTLLEFHYYM 1364 XP_004716076 1197 NSLPLPTTSPPEGFINLGADSYSLIKHKYSWF———-EADNNCKNQNSKIGSILDPYSNAFVWLHMQTSNVPVWI 1266 YP_003965969 470 RKNLGKCKE IFKRINQLRPDQaIRVIRDELGYEKKLVKM-CESLGFKK-EYLLSILNTLQGIGSKLETLKDFAERLN 544 ADU56613 1365 SDQLNKFVS[4]IGRFVAEFKSRF-Y-VWGDEVPLLTKFVAAaLHNIKCKEpHQLAETIDTIIDQSVANGVPVDLCNQIQ 1443 XP_004716076 1267 ALNSNLTKN EYAWTDNWRMRY-TNWAADEPKLKSACVY–LDTDG—-YWKTAHCNESLYSLCKRSDDIPATEPPQ 1336 YP_003965969 545 YLRKVLSQ—–SKFEKGKDVVTLSTFHSSKGLEFNQVIMIDLIEGVIPSK-EVIKDFKSGKIDEMEEAvRLFYVGMTR 618 ADU56613 1444 –KRTLSL–LCYAKYPIDPFLLNCETDVRDWVDGNRSYRIMRQIERLVPDAcKKMRSMLRILFNKLKTG-ELHEEFTTN 1518 XP_004716076 1337 LPGRCPESdhTAWIPFHGHCYYIE-SSYTRSWGQASLECLRMGSTLVSIESA–AESDFLSYRVEPLKSK-TNFWIGLYR 1412 YP_003965969 619 ———ARTDLELISYKRKDGESVQESSFVKDVKQIMFPNKGSKKKNVNQAKKIAFSDR–SNAFKNIEEVTIGSKV 687 ADU56613 1519 YLSGEHMTSLQNLFKLLNI—EPLSNSDLEFHWLNLATHYPLRMVLRQKIIYSGAVNLEDDRVPTIVKTLQNRLSSTFT 1595 XP_004716076 1413 NVDGMWLWINNNPVSFVNWNTGDPTGERNDCVHLLSASGFWNNIHCSSYKGYICKRPKILEAEPTHTLMTTKAEFRKMGP 1492 YP_003965969 688 KHATFGLGNIINVDTQIISIRFEKIGMKNLAAKICIEKGLLEAVAIADVG—————————— 737 ADU56613 1596 RGAQKLLSEAINKSAFQSSIASGFVGLCRTLGSKCVRGPNRENLYIRSIQSQLLETQGVEAVLGDNGIQIWRVSPEAKDG 1675 XP_004716076 1493 SKASSGVTGVVVTVVLMILVGAG——LTAYFFYKKRRMHPLGEGTFENTLYFNSRSTPGASDTKDLMGNIEQNEHAV 1566 YP_003965969 – ADU56613 1676 D[544] 2220 XP_004716076 1567 I 1567

QRNCRTAGVLGPVVGVIGTLQALEAIKMLAGIPLALS-GKLRLFDGK–QQSWSTLQLTKAAhCPACGGGL–
Selkov data origined here further inquiry. glutamine endpoint orf region above:
M.
The larger emerging premise is as follows:
Rejecting a research avenue of premised causality via in trisomy index case by natural selection, the research potential centers now upon the mannose protein relief. Interestingly, well researched by a Harvard team in 1990. Using the molecular toolbar *Selkov and the reassortment via polar affinity, which within the CNS data has been modified as selective for valene 117 mole weight endpoint pre fold, centric to further model. The homo sapien dynein axoemal heavy polypeptide, an additional contrast available…in regard to spindle residue alignments.
T vaginalis and yersina are two suspect oraganisms, both useful in contrasting data set for study via selkov. Interestingly, the active residues implicated in leishmanasis are also very closely conserved within this initial views of protein reaction chemistries.
An additional outlier arm of observation was the xodies scapularis mechanism as aromatic in evolved conservation, with citris fungi and mycosal interactiolns observed to premise adaptive resistance mechanism toward drug therapy.
Why the research is well served via cartilage assy is observed in AAH 08745 /BAG 53502 with the internal mechanism of gen variant. This is of particular interest when recalling the bat commensual viral load, crossing the species barrier as premised in corona studies. The aleptco species demonstrating a minute but potentially vital clue in the observed viral insult to the regionality of cartilage in homo sapiens as mechanism and pathogenesis.(unpublished). That same slight devation in residue may be causal to the trisomy variant conservation hence produced and conserved in C21 observation.
E. Telafari was my choice to demonstrate the particular intersection to mammal, via
AHK19521 at 188-265 demonstrated via cobalt as a promising selkov relief…to both typical selkov endpoint (204,240)and the newly operant 117. hERE, THE UNDERLYING MOLE WEIGHT AND AFFINITY driving the observational coherence of fold pre blast challenge in observation and subsequent typical blast output…as the end sort….data output regard.

I should pause here, and describe the larger implication.
As I hope the observer can tell, I am interested and motivated in this study. The underlying chemistry of the spindle was perhaps the most difficult, but pictographs were excellent and superb. *EMBO studies. Suggested for backgroud reading but not cited in instance here.
However, application of the fine apparatus in alignment resource, driven by new molecular toolbar resource, demonstrates a narrowing possible regard for mutation adventure.
Revisiting the particular protein residue data generated in the Harvard 1990 paper should be an excellent additive observation as specific to chromosome mutation premised by mechanism…if the mannose avenue is found succinct.

What I do regard as interesting, is that several of the adaptive toolbars and modeling should regard similar chromosomal mechanisms in equally fine relief…..to the regard of SNP…and typical small-large set…specifc to other case presentations at live birth and growth impacted, mechanism impacted at onset *specific to case
The citrus outlier, excellent material to launch a multi drug resistance view. Why? Because it contained Mycobacterium in similarity. I consider here MTB 37Rv.
The largest strength I bring to this work is the recent topic of index case in viral pathogen species, where 17 species are rather fully developed models. This eases the task when rejecting non mammalian terms as regard protein, and remaning centric to the organ studies vital to fully describe the Chromosome as described via OMIM gene map.
Fundamentally, this is a rather interesting topic. While just outside of my usual assay, I rather hope the newly developed tools will meet with continuing use in pathogenesis and homo sapien study via these and premised compound, theraputic design. A natural progression of this work. It does occur to me that within the narrowing focus, certain testing process could begin. Such test would be labeled antibody. Adequate primer design.
Aready demonstrated by protein specific residue and particulars above. Refinement, also, via V Cell model. Available at once.
Research copies of this text are typically saved to a protected data base via google drive.
This eases expense and makes the work aviable to review in every particular.

oncogene insult / mammalian residue via selkov

Onocogene insult at mammalian mesyenchymal region via selkov descriptor
AAF65445.1
mesenchymal stem cell protein DSC43 [Homo sapiens] >dbj|BAG36650.1| unnamed protein product [Homo sapiens] XP_006914186.1
PREDICTED: zinc finger protein 771 [Pteropus alecto] XP_003418900.1
PREDICTED: zinc finger protein 771-like [Loxodonta africana] NP_057727.2
zinc finger protein 771 [Homo sapiens] >ref|NP_001135777.1| zinc finger protein 771 [Homo sapiens] >ref|XP_510928.1| PREDICTED: zinc finger protein 771 [Pan troglodytes] >sp|Q7L3S4.1|ZN771_HUMAN RecName: Full=Zinc finger protein 771; AltName: Full=Mesenchymal stem cell protein DSC43 >gb|AAH11870.2| ZNF771 protein [Homo sapiens] AAH26192.2
ZNF771 protein [Homo sapiens] ELK10960.1
Zinc finger protein 771 [Pteropus alecto]
AAF65445 1 ——————————————MDNKEVPGEAPAPSADPARPHACPDCGRAFARRS 34 XP_006914186 1 MPGEQQTEEEEEEEMQEEMVLLVKSEEDEGEEKYEVVKLKIPMDNKEVPSEPPAPPADPARPHTCPDCGRAFARRS 76 XP_003418900 1 MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPTRPHACPDCGRAFARRS 76 NP_057727 1 MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPARPHACPDCGRAFARRS 76 AAH26192 1 MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPARPHACPDCGRAFARRS 76 ELK10960 1 [67]MPGEQQTEEEEEEEMQEEMVLLVKSEEDEGEEKYEVVKLKIPMDNKEVPSEPPAPPADPARPHTCPDCGRAFARRS
Here observe the alignment feature as truly well conserved at 100% across the cobalt constraints. Notice the mesyenchymal feature is addative to homo sapiens down codon in the view.
This intersection was observed with the selkov interpretation of mouse oncological active gene residue with isolucine determinant at endpoint in a high cystine content, high mole weigh pattern with features of repeat motief conserved to orf.
That exact blast submission as follows:
IVHVPKNNPNEGLGQNFLTTLKKTNLYCVALPPQACPNCGRRCCAFGGSPDNNPTNHQRCECAHFDCEDC
TATQPGSCG
the start of this study focus was as follows as blast challenge:
KLMATDPLINSYATKLHSLVTIFTLLVMTNLDVTSLAHISYIPIFQYDAPMDHDLITRPVDT
Where I used the high base feature mol weight 146 as start indicator in fold, in the initial view a single histadine draft feature.

Interior viral origin in pol via selkov

The residue study of active site flap, reverse transcriptase thumb domain in HIV pol identity.
by Mark McGary 5/17/2014

Few organizational motief’s in protein are as complex and difficult to assess as the intricate fold region of HIV pol. However, this interesting problem is modeled by the selkov technique and multiplex link assay.
Here, the observer needs to understand every passage in selkov determinant is poised within questions such as…..”Can I foresee mutation adventure within the assay? and….. “What specific observations are coherent?” Observationally, ready to sieze upon alignment and prophensity of multi species regard…..as to “What makes sense”.

Using the multivariant species….selkov view, the assay chain of events via reverse transcriptase thumb domain…as an active site flap… leads to tetraymena thermophila and papio anubis. *diguanyla cyclase, and the interesting pathogen sets of vibro, coriobacter g, ecor, streptococcus….within a replication related sequence data of hitherto impenetrable domain.
Here, one must take the view of an adventure in protein. Guided by selkov results.
As observationally coherent, the baboon residue as aligned within the HIV pol regionality are in the author’s humble opinion, unique towards the HIV ORF.
Here is a view of the ape-homo sapiens intersection in residue premised of substance within the transcriptional impact,
XP_003899201 2535 IHQFSTMIDDIKATQTDIKLSRYTAGSASPTPTFKTRKHRDFRSSDFSRSSRGSLNGGNRVNNAKNKRTNNENNKKESRN 2614 ETW57687 1075 WETFAPSIWNGMICALTYKDNSET-GPKGKAP—-KQNKDLKEKLWDNDGNKPKNG-NDYNSVTLKDENSGAQPNQTPS 1148 XP_001302210 540 VKQIMTVVHIDSNSLNEIDTIKVFVDICSKLIQDLDQKVRPILGFAGKVVEIPSQIGEYIDGLLKREEEKIEVIKKENSL 619 XP_002815313 1 ———————————————————————-MAVAAALTGL 10 EAX05237 510 IHQFSTMIDDIKATQTDIKLSRYTAGSASPTPTFKTRKHRDFRSSDFSRSSRGSLNGGNRVNNAKNKRTNNENNKKESRN 589 XP_003899201 2615 KNS ———-LGRSERRTSKVSRKGSKDVVDHMT IHMDDSDSITVSEQSEPSAECWQNMYKLLN——- 2671 ETW57687 1149 TTS[7]FVVRPPYFryLEEWGETFCRERRKRLRKIRGECT –KDGGKTKKCSGDGEYCEEIFSKKYNVLQDLSWSCA 1227 XP_001302210 620 KIK ELNSKLAD–VKQTNEALNDKLRKIAFELRTVF-[2]LEKTRKQNSALTEQLEVA—-TDRIEIEKGENTKIQ 688 XP_002815313 11 QAE[7]DYLSDPIT–IECGHNFCRSCIQQSWMDLQELFP[8]QEGHFRSNTQLGRMIEIAKLLQSTKSNKRKQEETTLC 97 EAX05237 590 KNS ———-LGRSERRTSKVSRKGSKDVVDHMT IHMDDSDSITVSEQSEPSAECWQNMYKLLN——- 646 XP_003899201 2672 —–FYSLISDPTGILEKSSETFGPAGVRSPTEPTCKVVFENEQDNSSLTKTQRKRSL-VTSEPQHvtlIVFGIGMVNR 2745 ETW57687 1228 KPCRLYKTWIEKKRTEFEEQKKAYGDQKQNCKEESKGA—QSNKDSNGVCGTLEKTCN-TAKD——FLQKLGPCSK 1297 XP_001302210 689 ERQNQYVSVIKSLQSEVKRQEALLK-ERQEVNERRIEQMLENERQLRFDEVDALKRKQKaELSELQN—-QVGRKREKL 763 XP_002815313 98 EKHNQPLSVFCKEDLMVLCPLCTQPPDHQGHHVRPIEKAAIHYRKRFCSYIQPLKK—-QLADLQK—-LISTQSKKP 169 EAX05237 647 —–FYSLISDPTGILEKSSETFGPAGVRSPTEPTCKVVFENEQDNSSLTKTQRKRSL-VTSEPQHvtlIVFGIGMVNR 720 XP_003899201 2746 THLEADIGGLTME–SELKRIHGS-FTLKEKMKDVLHQKMTE TCATAHIG—————-GVNIVLLEGIT 2803 ETW57687 1298 NNSGDDKKG—E–DEIKF———DDDKTFQHTNLCD PCSKFNVNCKENGNcTDVQGNTctGTTVITAENFK 1360 XP_001302210 764 SEIKVSLQKLREE-kEETEHALKMkITELEQENESTI-RMAE[3]VLCKSRIEELMQLN-TELEGKV–KSLALLSQRNS 838 XP_002815313 170 LELREMVENQRQElsSEFEHLNQF—-LDREQQAVLSRLAE[6]QKLSANITAFSNYS-ATLKSQL–SKVVELSELSE 245 EAX05237 721 THLEADIGGLTME–SELKRIHGS-FTLKEKMKDVLHQKMTE TCATAHIG—————-GVNIVLLEGIT 778
Plasmodium and trich. v. joining the viewpoint to observe pathogenesis descriptors as potentially conserved residue.
The underlying foment and decay indicators addative in insult….as active site flap regards completing the commensual additions to interior HIV evasion and conservation mechanism of sheer formatible uptake post corynebacter envelope transition, premised. Active residues of thermophyllic organism also contribute to active chemistries. As well as a curious mechanism observed in citrus residue linked decay.
Why the typical alignment tools do not adequately grapple with mutation adventure are regards of what view the observer determines via result. Here are the pathways observed incomplete, but which futher a more robust view of the HIV interior mechanisms, species insult and uptake, and provide interesting premise to treatment modality beyond the typical scope of sequence data toward a single species, single locus by assay of interior motiefs of actual conserved mutation. With the clear objective of a larger view in mutation, I trace the steps of adequate inquiry. The method of selkov as a multiplex view is rather an additional advance to the toolbar, but very useful indeed in large block assay of interior gene, specific to mutation adventure via species within the envelope domain of viral ORF.

To begin, I should introduce the reader to the parallel in sargauro cactus virus and HIV pol.
That is to ask….., “If the parallel in a single species is found coherent, would not more emerge with parallel method?
*exact blast challenge:
CLVEEKKITEHDLKVEVTLDHEHEDGDKRTCKKVGVVRLTFRKTMLANARLHEANRAGRTAS
results:
gb|AAB36707.1| replication-related protein [Saguaro cactus virus]” class=”deflnDesc” id=”deflnDesc_1″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_9629191″ ind=”1″ seqid=”9629191″ gi=”9629191″ seqfsta=”gi|9629191″ accs=”ref|NP_044383.1|” len=”31″ hsp=”1″ stat=”disp”replication-related protein [Saguaro cactus virus] >gb|AAB36707.1| replication-related protein [Saguaro cactus virus] 101 101 100% 1e-22 100% NP_044383.1 Select seq ref|NP_044382.1|
gb|AAB36710.1| SCVP86 [Saguaro cactus virus]” class=”deflnDesc” id=”deflnDesc_2″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_9629194″ ind=”2″ seqid=”9629194″ gi=”9629194″ seqfsta=”gi|9629194″ accs=”ref|NP_044382.1|” len=”31″ hsp=”1″ stat=”disp”SCVP86 [Saguaro cactus virus] >gb|AAB36710.1| SCVP86 [Saguaro cactus virus] 101 101 100% 2e-22 100% NP_044382.1 Select seq gb|ABB79924.1|
putative polymerase-associated protein [Pelargonium flower break virus] 51.1 51.1 70% 1e-05 74% ABB79924.1 Select seq gb|ABB79925.1|
RNA-dependent RNA polymerase [Pelargonium flower break virus] 51.1 51.1 70% 1e-05 74% ABB79925.1 Select seq ref|NP_945124.1|
emb|CAD55836.1| p27 protein [Pelargonium flower break virus]” class=”deflnDesc” id=”deflnDesc_5″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_39163633″ ind=”5″ seqid=”39163633″ gi=”39163633″ seqfsta=”gi|39163633″ accs=”ref|NP_945124.1|” len=”23″ hsp=”1″ stat=”disp”p27 protein [Pelargonium flower break virus] >emb|CAD55836.1| p27 protein [Pelargonium flower break virus] 50.7 50.7 70% 1e-05 74% NP_945124.1 Select seq ref|NP_945123.1|
emb|CAD55835.1| p86 protein [Pelargonium flower break virus]” class=”deflnDesc” id=”deflnDesc_6″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_39163632″ ind=”6″ seqid=”39163632″ gi=”39163632″ seqfsta=”gi|39163632″ accs=”ref|NP_945123.1|” len=”23″ hsp=”1″p86 protein [Pelargonium flower break virus] >emb|CAD55835.1| p86 protein [Pelargonium flower break virus] 50.7 50.7 70% 2e-05 74% NP_945123.1 Select seq ref|NP_945122.1|
emb|CAD55834.1| p99 protein [Pelargonium flower break virus]” class=”deflnDesc” id=”deflnDesc_7″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_39163631″ ind=”7″ seqid=”39163631″ gi=”39163631″ seqfsta=”gi|39163631″ accs=”ref|NP_945122.1|” len=”23″ hsp=”1″p99 protein [Pelargonium flower break virus] >emb|CAD55834.1| p99 protein [Pelargonium flower break virus] 50.7 50.7 70% 2e-05 74% NP_945122.1 Select seq ref|YP_008378652.1|
gb|ACT36595.1| P28 [Calibrachoa mottle virus]” class=”deflnDesc” id=”deflnDesc_8″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_529154248″ ind=”8″ seqid=”529154248″ gi=”529154248″ seqfsta=”gi|529154248″ accs=”ref|YP_008378652.1|” len=”33″ hsp=”1″P28 [Calibrachoa mottle virus] >gb|ACT36595.1| P28 [Calibrachoa mottle virus] 46.0 46.0 93% 4e-04 61% YP_008378652.1 Select seq ref|YP_008378651.1|
gb|ACT36594.1| P87 [Calibrachoa mottle virus]” class=”deflnDesc” id=”deflnDesc_9″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_529154247″ ind=”9″ seqid=”529154247″ gi=”529154247″ seqfsta=”gi|529154247″ accs=”ref|YP_008378651.1|” len=”33″ hsp=”1″P87 [Calibrachoa mottle virus] >gb|ACT36594.1| P87 [Calibrachoa mottle virus] 46.0 46.0 93% 5e-04 61% YP_008378651.1 Select seq ref|YP_004191790.1|
gb|ADV15467.1| p27 [Honeysuckle ringspot virus]” class=”deflnDesc” id=”deflnDesc_10″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_320202720″ ind=”10″ seqid=”320202720″ gi=”320202720″ seqfsta=”gi|320202720″ accs=”ref|YP_004191790.1|” len=”31″ hsp=”1″p27 [Honeysuckle ringspot virus] >gb|ADV15467.1| p27 [Honeysuckle ringspot virus] 36.3 36.3 93% 0.72 58% YP_004191790.1

Now with a multispecies view, inclusive of reptile, let us further examine the interesting observational motief presented above with a view to intersection with precursor elements.
The exact blast challenge, NCBI, NIH. Below:
CLVEEKKITEHDLKVEVTLDHEHEDGRKCTKKGVVVLRFTKRMTATANLREHHAARRGTSQ

Extracted species results, from larger output as larger interesting study notes:
Below:
XP_006485460.1
PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Citrus sinensis] CAI56756.1
hypothetical protein [Homo sapiens] ABM88765.1
erythrocyte membrane protein 1 [Plasmodium falciparum] BAG10419.1
KIAA1109 protein [synthetic construct] ABC59821.1
fragile site-associated protein [Homo sapiens] NP_056127.2
uncharacterized protein KIAA1109 [Homo sapiens] >ref|XP_005263344.1| PREDICTED: uncharacterized protein KIAA1109 isoform X6 [Homo sapiens] >sp|Q2LD37.2|K1109_HUMAN RecName: Full=Uncharacterized protein KIAA1109; AltName: Full=Fragile site-associated protein XP_005263343.1
PREDICTED: uncharacterized protein KIAA1109 isoform X5 [Homo sapiens] XP_005263342.1
PREDICTED: uncharacterized protein KIAA1109 isoform X4 [Homo sapiens] XP_005263339.1
PREDICTED: uncharacterized protein KIAA1109 isoform X1 [Homo sapiens] >ref|XP_005263340.1| PREDICTED: uncharacterized protein KIAA1109 isoform X2 [Homo sapiens] >ref|XP_005263341.1| PREDICTED: uncharacterized protein KIAA1109 isoform X3 [Homo sapiens] YP_002941222.1
ferric uptake regulator, Fur family [Kosmotoga olearia TBF 19.5.1] >ref|WP_015868863.1| Fur family transcriptional regulator [Kosmotoga olearia] >gb|ACR80218.1| ferric uptake regulator, Fur family [Kosmotoga olearia TBF 19.5.1] WP_002706615.1
CheW domain protein [Treponema saccharophilum] >gb|EIC00436.1| CheW domain protein [Treponema saccharophilum DSM 2985] XP_003896839.1
PREDICTED: thiamin pyrophosphokinase 1-like [Papio anubis] WP_009594072.1
hypothetical protein [Paenibacillus sp. HGF5] >gb|EGG34075.1| leucine rich repeat protein [Paenibacillus sp. HGF5] XP_005314453.1
PREDICTED: E3 ubiquitin-protein ligase RNF43-like isoform X2 [Chrysemys picta bellii]
Here, the data as a mined result has become observational from HIV-1 pol origin to a multispecies view, coherent in potential mechanisms and observational to the viral replication related protein. This is the viewpoint that might suggest an adequate index case assignment to the HIV virus particulars to pol origin. One must discard the pathogen set and full assess the primate to determine best further assessment regard, but happily, the set includes operant conservation of primate to gather a sense of where the pathogen insult must reside…and where multispecies….a firm understanding that the computational alogrythm has indeed aligned actual proteins in whatever regard as multispecies in origin….and must therefore be robust. The sheer power of this alignment can easily be overwhelming without regard to refinement in further selection. Here the application of additional selkov toolbar findings are additive to inquiry towards pathogenesis and mutation adventure as observed conserved and potential of insult…..and replication.

From the cobalt

Here is the set I am finding interesting in the
viral aspect of multi locus affinity,
additionally, paenibacilli was lost in the search aspect
and should be added. via blast.

The selkov view was dufffy with interior 204
as mutation adventure with single small draft, also 204.—————————————————————————
BAG54589 1 MEQPRKEVLASPDRLWGSRLTFNHDGSSRYGPRTYGTTTAPRDEDGSTLFRGWSQEGPVKSPAECREEHSKTPEE 75
NP_203754 1 [167]MEQPRKEVLASPDRLWGSRLTFNHDGSSRYGPRTYGTTTAPRDEDGSTLFRGWSQEGPVKSPAECREEHSKTPEE 242

NP_690895 ——————————————————————————–
BAG54589 76 RSLPSDLAFNGDLAKAASSELPADISKPWIPSSPAPSSENGGPASPGLPAEASGSGPGSPHLHPPDKSSPCHSQLLEAQS 155
NP_203754 243 RSLPSDLAFNGDLAKAASSELPADISKPWIPSSPAPSSENGGPASPGLPAEASGSGPGSPHLHPPDKSSPCHSQLLEAQT 322

NP_690895 1 ———-MFTNKAILAVyqLPEECTLEL—-VVRDGTGNLV–NSCYVETFQHRGNIKFGDRQAQVISHFNQVIDL 64
BAG54589 156 PEASQASPCPAVTPSAPSAA–LPDEGSRHTPSPGLPAEGAPEAPRPSSPPPEVLEPHSLDQPPATSPRPLIEVGELLDL 233
NP_203754 323 PEASQASPCPAVTPSAPSAA–LPDEGSRHTPSPGLPAEGAPEAPRPSSPPPEVLEPHSLDQPPATSPRPLIEVGELLDL 400

NP_690895 65 LRTSVSDSIDSM[6]QGNDDTR–ALVVRAMNDFF—PAKVGEAVFQAVQAALQGPGMLTTLmTRQLEFLGNTTL—- 138
BAG54589 234 TRTFPSGGEEEA KGDAHLRPTSLVQRRFSEGVLQSPSQDQEKLGGSLAALPQGQGSQLAL-DRPFGAESNWSLSQSF 309
NP_203754 401 TRTFPSGGEEEA KGDAHLRPTSLVQRRFSEGVLQSPSQDQEKLGGSLAALPQGQGSQLAL-DRPFGAESNWSLSQSF 476

NP_690895 139 —YNTRMLEAILHIVDTKR—-APAQDVAPVDYINGPAKTPLWEPYVVQCPDL–APTG——RVDVPDMHVTHNG 203
BAG54589 310 EWTFPTRPSGLGVWRLDSPPPSPITEASEAAEAAEAGNLAVSSREEGVSQQGQGAGSAPSGSGSSWVQGDDPSMSLTQKG 389
NP_203754 477 EWTFPTRPSGLGVWRLDSPPPSPITEASEAAEAAEAGNLAVSSREEGVSQQGQGAGSAPSGSGSSWVQGDDPSMSLTQKG 556

NP_690895 204 QPLTTAWYPPpASLRPL-LPDGTVGA———-NPEPSAAGAN————-FEP——PSASSRN—– 248
BAG54589 390 DGESQPQFPA-VPLEPLPTTEGTPGLPLQQAEERYESQEPLAGQESPLPLATREAALPILEPVLGQEQPAAPDQPCVLFA 468
NP_203754 557 DGESQPQFPA-VPLEPLPTTEGTPGLPLQQAEERYESQEPLAGQESPLPLATREAALPILEPVLGQEQPAAPDQPCVLFA 635

NP_690895 249 –PDDGGSTPVDTVEL——————RSATDVPENDHALRLLEEIARSHLPSHQQTHNMIVPQKDGAQGVVV 308
BAG54589 469 DAPEPGQALPVEEEAVTLARAETTQARTEAQDLCRASPEPPGPESSSRWLDDLLASPPPSGGGARRGAGAELKDTQSPST 548
NP_203754 636 DAPEPGQALPVEEEAVTLARAETTQARTEAQDLCRASPEPPGPESSSRWLDDLLASPPPSGGGARRGAGAELKDTQSPST 715

NP_690895 309 TPDYAKSGCKVDMQP-FHSYGGPNESHFAPMGIMLNYDK-YDCGFVIPLEDPRHTDCNlWTempTMRDDFARQG–RFW- 383
BAG54589 549 CSEGLLGWSQKDLQSEFGITGDPQPSSFSPSSWCQGASQDYGLGGASPRGDPGLGERD-WT—SKYGQGAGEGSTREWA 624
NP_203754 716 CSEGLLGWSQKDLQSEFGITGDPQPSSFSPSSWCQGASQDYGLGGASPRGDPGLGERD-WT—SKYGQGAGEGSTREWA 791

NP_690895 384 -RYDLNVDHFRECIAR-HTHVYADGA—–RLMGTFV-FELVKGERWTLEICSYRDRQFRSALLARATPRLMHALG— 452
BAG54589 625 SRCGIGQEEMEASSSQDQSKVSAPGVLTAQDRVVGKPAQLGTQRSQEADVQDWEFRKRDSQGTYSSRDAELQDQEFGKRD 704
NP_203754 792 SRCGIGQEEMEASSSQDQSKVSAPGVLTAQDRVVGKPAQLGTQRSQEADVQDWEFRKRDSQGTYSSRDAELQDQEFGKRD 871

NP_690895 453 -YGTNFGRFIIAMDPRMNLSDF—–PVDVMRPAE–GRRPcvcQESRGAGPLMDELDFYFEKNWNEL——–ERR 516
BAG54589 705 SLGTYSSRDVSLGDWEFGKRDSLGAYASQDANEQGQDLGKRD—HHGRYSSQDADEQDWEFQKRDVSLGTYGSRAAEPQ 781
NP_203754 872 SLGTYSSRDVSLGDWEFGKRDSLGAYASQDANEQGQDLGKRD—HHGRYSSQDADEQDWEFQKRDVSLGTYGSRAAEPQ 948

NP_690895 517 AQEGGEPKTLTRPTELIEALTALGKGTAFSLTPQKGSCVPTTMARM[5]ADEWAVILEKMATSLALAAAKEGNPAEAF– 596
BAG54589 782 EQEFGKSAWIRDYSSGGSSRTLDAQDRSFGTRPLSSGFSPEEAQQQ DEEFEKKIPSVEDSLGEGSRDAGRPGERGSG 858
NP_203754 949 EQEFGKSAWIRDYSSGGSSRTLDAQDRSFGTRPLSSGFSPEEAQQQ DEEFEKKIPSVEDSLGEGSRDAGRPGERGSG 1025

NP_690895 597 —————-YRDMSSWTNDERSR———————————–AMQLITWKRLAIN– 623
BAG54589 859 GLFSPSTAHVPDGALGQRDQSSWQNSDASQEVGGHQERQQAGAQGPGSADLEDGEMGKRGWVGEFSLSVGPQREAAFSPG 938
NP_203754 1026 GLFSPSTAHVPDGALGQRDQSSWQNSDASQEVGGHQERQQAGAQGPGSADLEDGEMGKRGWVGEFSLSVGPQREAAFSPG 1105

NP_690895 624 ——-FGVKVSMRA–LGVRNGYRVSRAAI-PKGVMA[8]GGHVCPECHSvfqSAGERKMCTTLDLMFHQLFLL—- 694
BAG54589 939 QQDWSRDFCIEASERSYQFGIIGNDRVSGAGFSPSSKME GGHFVPPGKT—TAGSVDWTDQLGLRNLEVSSCVGSG 1012
NP_203754 1106 QQDWSRDFCIEASERSYQFGIIGNDRVSGAGFSPSSKME GGHFVPPGKT—TAGSVDWTDQLGLRNLEVSSCVGSG 1179

NP_690895 695 ——–STGDV-WLGALVIHDprSHVSKTMKGVNRGANGGVKYEEIRKVRQFMVK—-FPFGRTCPH 751
BAG54589 1013 GSSEARESAVGQMGWSGGLSLRD–MNLTGCLESGGSEEPGGIGVGEKDWTSDVNVKSKDFITSG—– 1075
NP_203754 1180 GSSEARESAVGQMGWSGGLSLRD–MNLTGCLESGGSEEPGGIGVGEKDWTSDVNVKSKDLAEVGEGGGH[482] 1729

The selkov decade ahead

What was left unsaid in the Grand Challenge submission of 2014

It was a particularly difficult and observationally driven exercise to enter the Grand Challenge as regards enteric immune insult.

What was not said in the small mission statement was that, in fact, the interior relatinships of clostridium botulinum and streptococci s are now defined. Consider the potent chemistry of the most deadly substance. How does the pathogen isolate that product?
Enter streptococci…..the grouping in view with a ruminant mutation uptake directly adjacent in genetic residue set *observed in ebov, agl 73453.1.

Much of the Kegg, toolbar prodctivity of modern molecular tools is shaped by observation of like (objects in residue).
The advantage of a tool that shapes active interior is much more forward thinking, and while a bit radical, in combonational end use, is far ahead of many of tools lacking the fine foci and interior mutation uptake as view available, not seen in Kegg and the quantifieid annotation.

Selkov toolbar assay of Hepatitis B residue describes current faulty orf

Fundamentally, the study of the Hepatitis virus of B typeform has allowed serious flaws to limit the investigational aspects of host presentation.

1. The nomenclature is muddled and indistinct, creating a confusing and unclear assessment.

2. The specific start codon of product is mis represented.

3. The mutation adventure as described via host pressure is not well founded.
With the assessment of viral insult to population, a rethinking of approach in the study to immune response seems vital and well crafted science, neglected by the simple addative approach that seems murky and indistinct. A new clarity has begun.
A complete ORF alignment is described.
Selkov toolbar is engaged.
The mutation adventure is observed as typical in viral species to describe the index case in species.

Execution of a blast search on the first orf residues produces:

Execution of a blast search on the last line of ofr residues produces a multivariant
draft of protein with observed internal non alignment.
Hence, rather variant product and/or conservation is premised.
Why has succinct and well defined component been neglected? The author suspects a lack of assay tools has allowed poorly defined or mis representational protein assignment.
Clearly, the variant protein residues observed internal to the orf with similar nomenclature weakens adequate identifiers towards this residue set.
Here, the observational quality of the Selkov toolbar is fully engaged and a definition of precursor uptake as conserved mutation fully eleucedated to define the pathogen observed in residue.

Unusual set with poplar interaction described as unknown?
WP_019422196 1 MTEKKEIIEIGWNFDNSYACLPE LFFTKLDPTPVRSPKLMILNDSLAPSLGLNVEALQSTDGVAVFAGN QVPE 73 WP_016416158 1 MASD-ETLEV-YQGDKYVGRLHD AQPLRFEYDPAWQER——HLSPSLPLS-QQVHVGDEVLAYFEN LLPE 64 XP_007288702 1 MLSNPLHRYSAYDALPSSSMLPN[12]LQTLADGSQYALQQMHQQHQQHHQQHQHVEVSHVPRNDHEVQRSQN[4]QHPY 89 WP_019422196 74 GALP————–LAQAYAGHQFGHFTMLGDGRA[5]QITPLGERVDIQLKGSGRTPYSRRgdGRAALGPMLREY 141 WP_016416158 65 GDLRHHLELCHHTTTVFGLLKAIGGDTASSFTLLPPGES PAPPHYRPISWEALEEHLRHRER——–GPLLSQQ 133 XP_007288702 90 SAAGQGRGLSSASSGPIRRRISRACDQCNQLRTKCDGQS —PCAHCVEFGLGCEYIRERKKR–GKASRKDLAQQ- 160 WP_019422196 142 IISEAMHSLGIATTRSLAVVTTGESVIRETEQPGAILTRVAASHLRVGTFQYVSNWGNVQDLRTLAD-YTLQRHFPKVDA 220 WP_016416158 134 SEEARISLAGAQDKLLLMVLEDGSPAIPEGSAPSSHILKPDIQGLRGVWGSAINETFCMQLAAELGL-EVAGASYQP— 209 XP_007288702 161 –AAATAASGGQEAPSGGGQGHGQSSDEPASPPESRHEHESSSATPTQQETGVLRRSQASRSLSLCLgRTASELDPASGR 238 WP_019422196 221 DENRFLVLLKEVIKLQAVLISKWQLVGFIHGVMNTDNMALSGETIDYGPCAFMDTYDPETVFSSIDMDGRYAYGNQPNIA 300 WP_016416158 210 ————-ETRACLVRRYDRVPDEQGGLRRLHQ——LDFCQLAGTPSLIKYESDGGPGLARCRELLQQVGTP 270 XP_007288702 239 DATQGRLQRAGSLESLTGLVPHMASRADPDQIESPASLTMSSYSSLHGYRPALESHLLRGSTGSGGGQSSFAAG-QGSLP 317 WP_019422196 301 AWNLARFAEALLPLLHDNELQAVQLAEDAISEFFELYHRNWLEGMRGKLGIFNEEEQ-DESLMDGLLSMMQKYRADYTNT 379 WP_016416158 271 AKDLQRLIGWF———————FFNLLIGNNDSHAKNLAILYTDEGP-RLAPFYDLMSTTLYSGFSRRFA 328 XP_007288702 318 GFDLSYAIQAPSPTTHYPAPSTTPGPFHLGDSPISGFPMASEAASPGWMSLPSPSNQyRQHVPSPSFSTTLRLPVLQPLI 397 WP_019422196 380 FRALTFEKSENTALFGSTEYAEWHELWQARLTRQQESKASSQQL-MRSSNPALIPRNHRVEEALEAAVKQGDYSVmerLL 458 WP_016416158 329 FRVAEEDRP——GNIERSHLESL–ARAMRFQPRYFLRQGLELTEQMPAATDSTLATLATLGAEAHQGTEQT—L- 396 XP_007288702 398 PYLGNIIPVSLACDLLDLYFASSSSALMHPTSPYVLGYVFRKQSILHRTKPR–PCTPALLASMLWVVAQTSDAS—FL 472 WP_019422196 459 DVLSSPYAHSIEQVEYSTLPALSPRSYRTFCGT- 491 WP_016416158 397 ———-LERLQQRLMSNCRKLTVRWAVGGS 420 XP_007288702 473 TAPPSSRGRVCQRLLELTVGLLKPL-IHGSAGDE[488] 993

Here the isolucine selkov is descriptive of true mutation, adventure.

Internal to the rather wide oraganism based vis is the hidden internal structure ,

shared and conserved in the viral insult .
I observe transcriptional regulators, hence the sequence data is premised corrupt.
There may be zero overlap as I first surmised.
The typical bacteriodies dna repair, Bartonella, paenicibacilli, Campobacter j, thioalkalivibro,
(inserts glutamine and hence conserved mutant),
zone of mammal pteropus slecto residue?
and the isolucine selkov view below: elegant really in reducing interior pattern to view.
YP_008014455 1 [1]—–GGAPSGSLGVLLPHLELASLLDQCVDRLVRVTSRAHDVQDEEQRVDLMVGLTKAAEALRASER–CDHEPAE 71 WP_007035058 1 [6]AGNGKGGAPPMPLGVLMPSLELASWLDRYVDRIVRADPKGDDALASEQRVDLMVGLAKAAEALRASAR–CDPESAE 81 YP_001755765 1 MDSFRPHLAKVAGGLALDRAEARAAFDDLLSGEVTPVQAGAFLTALKVRGESVEEIVGAAEAMRARMTRvAAPENAV 77 WP_004951341 1 ————————————MPDVHVPIPAETRDRLTAAAAAEGLSLRAHLMR—–LAG 36 WP_019972841 1 [5]ESRRRIEAAIVEIGRRHLVTEGAAGLSLRAVARELGMVSSAIYRYVADRDDLLTLLVVDAYSELADAVD—–QAA 77 YP_008014455 72 RLLRSALDLMRGVDLNRFALSDR—————————- 94 WP_007035058 82 YELRSALELMRGIDLDRFALFAH—————————- 104 YP_001755765 78 DVVGTGGDHSGSVNVSTLAAIVVaACGVPVAKHGNRAATSRSGAADVLAAL[217] 345 WP_004951341 37 DSARPARDGTRA-DRVRQALHAWnGYDPDPEEEARLDAELDRRIAEAAATG 86 WP_019972841 78 AGLSVESDWRTRLSEMAYAVRRW-AIDQPARWALLYGSPVPGYHAPAERTV[101] 228