oncogene insult / mammalian residue via selkov

Onocogene insult at mammalian mesyenchymal region via selkov descriptor
AAF65445.1
mesenchymal stem cell protein DSC43 [Homo sapiens] >dbj|BAG36650.1| unnamed protein product [Homo sapiens] XP_006914186.1
PREDICTED: zinc finger protein 771 [Pteropus alecto] XP_003418900.1
PREDICTED: zinc finger protein 771-like [Loxodonta africana] NP_057727.2
zinc finger protein 771 [Homo sapiens] >ref|NP_001135777.1| zinc finger protein 771 [Homo sapiens] >ref|XP_510928.1| PREDICTED: zinc finger protein 771 [Pan troglodytes] >sp|Q7L3S4.1|ZN771_HUMAN RecName: Full=Zinc finger protein 771; AltName: Full=Mesenchymal stem cell protein DSC43 >gb|AAH11870.2| ZNF771 protein [Homo sapiens] AAH26192.2
ZNF771 protein [Homo sapiens] ELK10960.1
Zinc finger protein 771 [Pteropus alecto]
AAF65445 1 ——————————————MDNKEVPGEAPAPSADPARPHACPDCGRAFARRS 34 XP_006914186 1 MPGEQQTEEEEEEEMQEEMVLLVKSEEDEGEEKYEVVKLKIPMDNKEVPSEPPAPPADPARPHTCPDCGRAFARRS 76 XP_003418900 1 MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPTRPHACPDCGRAFARRS 76 NP_057727 1 MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPARPHACPDCGRAFARRS 76 AAH26192 1 MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPARPHACPDCGRAFARRS 76 ELK10960 1 [67]MPGEQQTEEEEEEEMQEEMVLLVKSEEDEGEEKYEVVKLKIPMDNKEVPSEPPAPPADPARPHTCPDCGRAFARRS
Here observe the alignment feature as truly well conserved at 100% across the cobalt constraints. Notice the mesyenchymal feature is addative to homo sapiens down codon in the view.
This intersection was observed with the selkov interpretation of mouse oncological active gene residue with isolucine determinant at endpoint in a high cystine content, high mole weigh pattern with features of repeat motief conserved to orf.
That exact blast submission as follows:
IVHVPKNNPNEGLGQNFLTTLKKTNLYCVALPPQACPNCGRRCCAFGGSPDNNPTNHQRCECAHFDCEDC
TATQPGSCG
the start of this study focus was as follows as blast challenge:
KLMATDPLINSYATKLHSLVTIFTLLVMTNLDVTSLAHISYIPIFQYDAPMDHDLITRPVDT
Where I used the high base feature mol weight 146 as start indicator in fold, in the initial view a single histadine draft feature.

Advertisements

Leave a Reply

Fill in your details below or click an icon to log in:

WordPress.com Logo

You are commenting using your WordPress.com account. Log Out / Change )

Twitter picture

You are commenting using your Twitter account. Log Out / Change )

Facebook photo

You are commenting using your Facebook account. Log Out / Change )

Google+ photo

You are commenting using your Google+ account. Log Out / Change )

Connecting to %s