oncogene insult / mammalian residue via selkov

Onocogene insult at mammalian mesyenchymal region via selkov descriptor
AAF65445.1
mesenchymal stem cell protein DSC43 [Homo sapiens] >dbj|BAG36650.1| unnamed protein product [Homo sapiens] XP_006914186.1
PREDICTED: zinc finger protein 771 [Pteropus alecto] XP_003418900.1
PREDICTED: zinc finger protein 771-like [Loxodonta africana] NP_057727.2
zinc finger protein 771 [Homo sapiens] >ref|NP_001135777.1| zinc finger protein 771 [Homo sapiens] >ref|XP_510928.1| PREDICTED: zinc finger protein 771 [Pan troglodytes] >sp|Q7L3S4.1|ZN771_HUMAN RecName: Full=Zinc finger protein 771; AltName: Full=Mesenchymal stem cell protein DSC43 >gb|AAH11870.2| ZNF771 protein [Homo sapiens] AAH26192.2
ZNF771 protein [Homo sapiens] ELK10960.1
Zinc finger protein 771 [Pteropus alecto]
AAF65445 1 ——————————————MDNKEVPGEAPAPSADPARPHACPDCGRAFARRS 34 XP_006914186 1 MPGEQQTEEEEEEEMQEEMVLLVKSEEDEGEEKYEVVKLKIPMDNKEVPSEPPAPPADPARPHTCPDCGRAFARRS 76 XP_003418900 1 MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPTRPHACPDCGRAFARRS 76 NP_057727 1 MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPARPHACPDCGRAFARRS 76 AAH26192 1 MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPARPHACPDCGRAFARRS 76 ELK10960 1 [67]MPGEQQTEEEEEEEMQEEMVLLVKSEEDEGEEKYEVVKLKIPMDNKEVPSEPPAPPADPARPHTCPDCGRAFARRS
Here observe the alignment feature as truly well conserved at 100% across the cobalt constraints. Notice the mesyenchymal feature is addative to homo sapiens down codon in the view.
This intersection was observed with the selkov interpretation of mouse oncological active gene residue with isolucine determinant at endpoint in a high cystine content, high mole weigh pattern with features of repeat motief conserved to orf.
That exact blast submission as follows:
IVHVPKNNPNEGLGQNFLTTLKKTNLYCVALPPQACPNCGRRCCAFGGSPDNNPTNHQRCECAHFDCEDC
TATQPGSCG
the start of this study focus was as follows as blast challenge:
KLMATDPLINSYATKLHSLVTIFTLLVMTNLDVTSLAHISYIPIFQYDAPMDHDLITRPVDT
Where I used the high base feature mol weight 146 as start indicator in fold, in the initial view a single histadine draft feature.

Advertisements

Interior viral origin in pol via selkov

The residue study of active site flap, reverse transcriptase thumb domain in HIV pol identity.
by Mark McGary 5/17/2014

Few organizational motief’s in protein are as complex and difficult to assess as the intricate fold region of HIV pol. However, this interesting problem is modeled by the selkov technique and multiplex link assay.
Here, the observer needs to understand every passage in selkov determinant is poised within questions such as…..”Can I foresee mutation adventure within the assay? and….. “What specific observations are coherent?” Observationally, ready to sieze upon alignment and prophensity of multi species regard…..as to “What makes sense”.

Using the multivariant species….selkov view, the assay chain of events via reverse transcriptase thumb domain…as an active site flap… leads to tetraymena thermophila and papio anubis. *diguanyla cyclase, and the interesting pathogen sets of vibro, coriobacter g, ecor, streptococcus….within a replication related sequence data of hitherto impenetrable domain.
Here, one must take the view of an adventure in protein. Guided by selkov results.
As observationally coherent, the baboon residue as aligned within the HIV pol regionality are in the author’s humble opinion, unique towards the HIV ORF.
Here is a view of the ape-homo sapiens intersection in residue premised of substance within the transcriptional impact,
XP_003899201 2535 IHQFSTMIDDIKATQTDIKLSRYTAGSASPTPTFKTRKHRDFRSSDFSRSSRGSLNGGNRVNNAKNKRTNNENNKKESRN 2614 ETW57687 1075 WETFAPSIWNGMICALTYKDNSET-GPKGKAP—-KQNKDLKEKLWDNDGNKPKNG-NDYNSVTLKDENSGAQPNQTPS 1148 XP_001302210 540 VKQIMTVVHIDSNSLNEIDTIKVFVDICSKLIQDLDQKVRPILGFAGKVVEIPSQIGEYIDGLLKREEEKIEVIKKENSL 619 XP_002815313 1 ———————————————————————-MAVAAALTGL 10 EAX05237 510 IHQFSTMIDDIKATQTDIKLSRYTAGSASPTPTFKTRKHRDFRSSDFSRSSRGSLNGGNRVNNAKNKRTNNENNKKESRN 589 XP_003899201 2615 KNS ———-LGRSERRTSKVSRKGSKDVVDHMT IHMDDSDSITVSEQSEPSAECWQNMYKLLN——- 2671 ETW57687 1149 TTS[7]FVVRPPYFryLEEWGETFCRERRKRLRKIRGECT –KDGGKTKKCSGDGEYCEEIFSKKYNVLQDLSWSCA 1227 XP_001302210 620 KIK ELNSKLAD–VKQTNEALNDKLRKIAFELRTVF-[2]LEKTRKQNSALTEQLEVA—-TDRIEIEKGENTKIQ 688 XP_002815313 11 QAE[7]DYLSDPIT–IECGHNFCRSCIQQSWMDLQELFP[8]QEGHFRSNTQLGRMIEIAKLLQSTKSNKRKQEETTLC 97 EAX05237 590 KNS ———-LGRSERRTSKVSRKGSKDVVDHMT IHMDDSDSITVSEQSEPSAECWQNMYKLLN——- 646 XP_003899201 2672 —–FYSLISDPTGILEKSSETFGPAGVRSPTEPTCKVVFENEQDNSSLTKTQRKRSL-VTSEPQHvtlIVFGIGMVNR 2745 ETW57687 1228 KPCRLYKTWIEKKRTEFEEQKKAYGDQKQNCKEESKGA—QSNKDSNGVCGTLEKTCN-TAKD——FLQKLGPCSK 1297 XP_001302210 689 ERQNQYVSVIKSLQSEVKRQEALLK-ERQEVNERRIEQMLENERQLRFDEVDALKRKQKaELSELQN—-QVGRKREKL 763 XP_002815313 98 EKHNQPLSVFCKEDLMVLCPLCTQPPDHQGHHVRPIEKAAIHYRKRFCSYIQPLKK—-QLADLQK—-LISTQSKKP 169 EAX05237 647 —–FYSLISDPTGILEKSSETFGPAGVRSPTEPTCKVVFENEQDNSSLTKTQRKRSL-VTSEPQHvtlIVFGIGMVNR 720 XP_003899201 2746 THLEADIGGLTME–SELKRIHGS-FTLKEKMKDVLHQKMTE TCATAHIG—————-GVNIVLLEGIT 2803 ETW57687 1298 NNSGDDKKG—E–DEIKF———DDDKTFQHTNLCD PCSKFNVNCKENGNcTDVQGNTctGTTVITAENFK 1360 XP_001302210 764 SEIKVSLQKLREE-kEETEHALKMkITELEQENESTI-RMAE[3]VLCKSRIEELMQLN-TELEGKV–KSLALLSQRNS 838 XP_002815313 170 LELREMVENQRQElsSEFEHLNQF—-LDREQQAVLSRLAE[6]QKLSANITAFSNYS-ATLKSQL–SKVVELSELSE 245 EAX05237 721 THLEADIGGLTME–SELKRIHGS-FTLKEKMKDVLHQKMTE TCATAHIG—————-GVNIVLLEGIT 778
Plasmodium and trich. v. joining the viewpoint to observe pathogenesis descriptors as potentially conserved residue.
The underlying foment and decay indicators addative in insult….as active site flap regards completing the commensual additions to interior HIV evasion and conservation mechanism of sheer formatible uptake post corynebacter envelope transition, premised. Active residues of thermophyllic organism also contribute to active chemistries. As well as a curious mechanism observed in citrus residue linked decay.
Why the typical alignment tools do not adequately grapple with mutation adventure are regards of what view the observer determines via result. Here are the pathways observed incomplete, but which futher a more robust view of the HIV interior mechanisms, species insult and uptake, and provide interesting premise to treatment modality beyond the typical scope of sequence data toward a single species, single locus by assay of interior motiefs of actual conserved mutation. With the clear objective of a larger view in mutation, I trace the steps of adequate inquiry. The method of selkov as a multiplex view is rather an additional advance to the toolbar, but very useful indeed in large block assay of interior gene, specific to mutation adventure via species within the envelope domain of viral ORF.

To begin, I should introduce the reader to the parallel in sargauro cactus virus and HIV pol.
That is to ask….., “If the parallel in a single species is found coherent, would not more emerge with parallel method?
*exact blast challenge:
CLVEEKKITEHDLKVEVTLDHEHEDGDKRTCKKVGVVRLTFRKTMLANARLHEANRAGRTAS
results:
gb|AAB36707.1| replication-related protein [Saguaro cactus virus]” class=”deflnDesc” id=”deflnDesc_1″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_9629191″ ind=”1″ seqid=”9629191″ gi=”9629191″ seqfsta=”gi|9629191″ accs=”ref|NP_044383.1|” len=”31″ hsp=”1″ stat=”disp”replication-related protein [Saguaro cactus virus] >gb|AAB36707.1| replication-related protein [Saguaro cactus virus] 101 101 100% 1e-22 100% NP_044383.1 Select seq ref|NP_044382.1|
gb|AAB36710.1| SCVP86 [Saguaro cactus virus]” class=”deflnDesc” id=”deflnDesc_2″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_9629194″ ind=”2″ seqid=”9629194″ gi=”9629194″ seqfsta=”gi|9629194″ accs=”ref|NP_044382.1|” len=”31″ hsp=”1″ stat=”disp”SCVP86 [Saguaro cactus virus] >gb|AAB36710.1| SCVP86 [Saguaro cactus virus] 101 101 100% 2e-22 100% NP_044382.1 Select seq gb|ABB79924.1|
putative polymerase-associated protein [Pelargonium flower break virus] 51.1 51.1 70% 1e-05 74% ABB79924.1 Select seq gb|ABB79925.1|
RNA-dependent RNA polymerase [Pelargonium flower break virus] 51.1 51.1 70% 1e-05 74% ABB79925.1 Select seq ref|NP_945124.1|
emb|CAD55836.1| p27 protein [Pelargonium flower break virus]” class=”deflnDesc” id=”deflnDesc_5″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_39163633″ ind=”5″ seqid=”39163633″ gi=”39163633″ seqfsta=”gi|39163633″ accs=”ref|NP_945124.1|” len=”23″ hsp=”1″ stat=”disp”p27 protein [Pelargonium flower break virus] >emb|CAD55836.1| p27 protein [Pelargonium flower break virus] 50.7 50.7 70% 1e-05 74% NP_945124.1 Select seq ref|NP_945123.1|
emb|CAD55835.1| p86 protein [Pelargonium flower break virus]” class=”deflnDesc” id=”deflnDesc_6″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_39163632″ ind=”6″ seqid=”39163632″ gi=”39163632″ seqfsta=”gi|39163632″ accs=”ref|NP_945123.1|” len=”23″ hsp=”1″p86 protein [Pelargonium flower break virus] >emb|CAD55835.1| p86 protein [Pelargonium flower break virus] 50.7 50.7 70% 2e-05 74% NP_945123.1 Select seq ref|NP_945122.1|
emb|CAD55834.1| p99 protein [Pelargonium flower break virus]” class=”deflnDesc” id=”deflnDesc_7″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_39163631″ ind=”7″ seqid=”39163631″ gi=”39163631″ seqfsta=”gi|39163631″ accs=”ref|NP_945122.1|” len=”23″ hsp=”1″p99 protein [Pelargonium flower break virus] >emb|CAD55834.1| p99 protein [Pelargonium flower break virus] 50.7 50.7 70% 2e-05 74% NP_945122.1 Select seq ref|YP_008378652.1|
gb|ACT36595.1| P28 [Calibrachoa mottle virus]” class=”deflnDesc” id=”deflnDesc_8″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_529154248″ ind=”8″ seqid=”529154248″ gi=”529154248″ seqfsta=”gi|529154248″ accs=”ref|YP_008378652.1|” len=”33″ hsp=”1″P28 [Calibrachoa mottle virus] >gb|ACT36595.1| P28 [Calibrachoa mottle virus] 46.0 46.0 93% 4e-04 61% YP_008378652.1 Select seq ref|YP_008378651.1|
gb|ACT36594.1| P87 [Calibrachoa mottle virus]” class=”deflnDesc” id=”deflnDesc_9″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_529154247″ ind=”9″ seqid=”529154247″ gi=”529154247″ seqfsta=”gi|529154247″ accs=”ref|YP_008378651.1|” len=”33″ hsp=”1″P87 [Calibrachoa mottle virus] >gb|ACT36594.1| P87 [Calibrachoa mottle virus] 46.0 46.0 93% 5e-04 61% YP_008378651.1 Select seq ref|YP_004191790.1|
gb|ADV15467.1| p27 [Honeysuckle ringspot virus]” class=”deflnDesc” id=”deflnDesc_10″ onclick=”DisplayAlignFromDescription(this);” href=”#alnHdr_320202720″ ind=”10″ seqid=”320202720″ gi=”320202720″ seqfsta=”gi|320202720″ accs=”ref|YP_004191790.1|” len=”31″ hsp=”1″p27 [Honeysuckle ringspot virus] >gb|ADV15467.1| p27 [Honeysuckle ringspot virus] 36.3 36.3 93% 0.72 58% YP_004191790.1

Now with a multispecies view, inclusive of reptile, let us further examine the interesting observational motief presented above with a view to intersection with precursor elements.
The exact blast challenge, NCBI, NIH. Below:
CLVEEKKITEHDLKVEVTLDHEHEDGRKCTKKGVVVLRFTKRMTATANLREHHAARRGTSQ

Extracted species results, from larger output as larger interesting study notes:
Below:
XP_006485460.1
PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Citrus sinensis] CAI56756.1
hypothetical protein [Homo sapiens] ABM88765.1
erythrocyte membrane protein 1 [Plasmodium falciparum] BAG10419.1
KIAA1109 protein [synthetic construct] ABC59821.1
fragile site-associated protein [Homo sapiens] NP_056127.2
uncharacterized protein KIAA1109 [Homo sapiens] >ref|XP_005263344.1| PREDICTED: uncharacterized protein KIAA1109 isoform X6 [Homo sapiens] >sp|Q2LD37.2|K1109_HUMAN RecName: Full=Uncharacterized protein KIAA1109; AltName: Full=Fragile site-associated protein XP_005263343.1
PREDICTED: uncharacterized protein KIAA1109 isoform X5 [Homo sapiens] XP_005263342.1
PREDICTED: uncharacterized protein KIAA1109 isoform X4 [Homo sapiens] XP_005263339.1
PREDICTED: uncharacterized protein KIAA1109 isoform X1 [Homo sapiens] >ref|XP_005263340.1| PREDICTED: uncharacterized protein KIAA1109 isoform X2 [Homo sapiens] >ref|XP_005263341.1| PREDICTED: uncharacterized protein KIAA1109 isoform X3 [Homo sapiens] YP_002941222.1
ferric uptake regulator, Fur family [Kosmotoga olearia TBF 19.5.1] >ref|WP_015868863.1| Fur family transcriptional regulator [Kosmotoga olearia] >gb|ACR80218.1| ferric uptake regulator, Fur family [Kosmotoga olearia TBF 19.5.1] WP_002706615.1
CheW domain protein [Treponema saccharophilum] >gb|EIC00436.1| CheW domain protein [Treponema saccharophilum DSM 2985] XP_003896839.1
PREDICTED: thiamin pyrophosphokinase 1-like [Papio anubis] WP_009594072.1
hypothetical protein [Paenibacillus sp. HGF5] >gb|EGG34075.1| leucine rich repeat protein [Paenibacillus sp. HGF5] XP_005314453.1
PREDICTED: E3 ubiquitin-protein ligase RNF43-like isoform X2 [Chrysemys picta bellii]
Here, the data as a mined result has become observational from HIV-1 pol origin to a multispecies view, coherent in potential mechanisms and observational to the viral replication related protein. This is the viewpoint that might suggest an adequate index case assignment to the HIV virus particulars to pol origin. One must discard the pathogen set and full assess the primate to determine best further assessment regard, but happily, the set includes operant conservation of primate to gather a sense of where the pathogen insult must reside…and where multispecies….a firm understanding that the computational alogrythm has indeed aligned actual proteins in whatever regard as multispecies in origin….and must therefore be robust. The sheer power of this alignment can easily be overwhelming without regard to refinement in further selection. Here the application of additional selkov toolbar findings are additive to inquiry towards pathogenesis and mutation adventure as observed conserved and potential of insult…..and replication.

From the cobalt

Here is the set I am finding interesting in the
viral aspect of multi locus affinity,
additionally, paenibacilli was lost in the search aspect
and should be added. via blast.

The selkov view was dufffy with interior 204
as mutation adventure with single small draft, also 204.—————————————————————————
BAG54589 1 MEQPRKEVLASPDRLWGSRLTFNHDGSSRYGPRTYGTTTAPRDEDGSTLFRGWSQEGPVKSPAECREEHSKTPEE 75
NP_203754 1 [167]MEQPRKEVLASPDRLWGSRLTFNHDGSSRYGPRTYGTTTAPRDEDGSTLFRGWSQEGPVKSPAECREEHSKTPEE 242

NP_690895 ——————————————————————————–
BAG54589 76 RSLPSDLAFNGDLAKAASSELPADISKPWIPSSPAPSSENGGPASPGLPAEASGSGPGSPHLHPPDKSSPCHSQLLEAQS 155
NP_203754 243 RSLPSDLAFNGDLAKAASSELPADISKPWIPSSPAPSSENGGPASPGLPAEASGSGPGSPHLHPPDKSSPCHSQLLEAQT 322

NP_690895 1 ———-MFTNKAILAVyqLPEECTLEL—-VVRDGTGNLV–NSCYVETFQHRGNIKFGDRQAQVISHFNQVIDL 64
BAG54589 156 PEASQASPCPAVTPSAPSAA–LPDEGSRHTPSPGLPAEGAPEAPRPSSPPPEVLEPHSLDQPPATSPRPLIEVGELLDL 233
NP_203754 323 PEASQASPCPAVTPSAPSAA–LPDEGSRHTPSPGLPAEGAPEAPRPSSPPPEVLEPHSLDQPPATSPRPLIEVGELLDL 400

NP_690895 65 LRTSVSDSIDSM[6]QGNDDTR–ALVVRAMNDFF—PAKVGEAVFQAVQAALQGPGMLTTLmTRQLEFLGNTTL—- 138
BAG54589 234 TRTFPSGGEEEA KGDAHLRPTSLVQRRFSEGVLQSPSQDQEKLGGSLAALPQGQGSQLAL-DRPFGAESNWSLSQSF 309
NP_203754 401 TRTFPSGGEEEA KGDAHLRPTSLVQRRFSEGVLQSPSQDQEKLGGSLAALPQGQGSQLAL-DRPFGAESNWSLSQSF 476

NP_690895 139 —YNTRMLEAILHIVDTKR—-APAQDVAPVDYINGPAKTPLWEPYVVQCPDL–APTG——RVDVPDMHVTHNG 203
BAG54589 310 EWTFPTRPSGLGVWRLDSPPPSPITEASEAAEAAEAGNLAVSSREEGVSQQGQGAGSAPSGSGSSWVQGDDPSMSLTQKG 389
NP_203754 477 EWTFPTRPSGLGVWRLDSPPPSPITEASEAAEAAEAGNLAVSSREEGVSQQGQGAGSAPSGSGSSWVQGDDPSMSLTQKG 556

NP_690895 204 QPLTTAWYPPpASLRPL-LPDGTVGA———-NPEPSAAGAN————-FEP——PSASSRN—– 248
BAG54589 390 DGESQPQFPA-VPLEPLPTTEGTPGLPLQQAEERYESQEPLAGQESPLPLATREAALPILEPVLGQEQPAAPDQPCVLFA 468
NP_203754 557 DGESQPQFPA-VPLEPLPTTEGTPGLPLQQAEERYESQEPLAGQESPLPLATREAALPILEPVLGQEQPAAPDQPCVLFA 635

NP_690895 249 –PDDGGSTPVDTVEL——————RSATDVPENDHALRLLEEIARSHLPSHQQTHNMIVPQKDGAQGVVV 308
BAG54589 469 DAPEPGQALPVEEEAVTLARAETTQARTEAQDLCRASPEPPGPESSSRWLDDLLASPPPSGGGARRGAGAELKDTQSPST 548
NP_203754 636 DAPEPGQALPVEEEAVTLARAETTQARTEAQDLCRASPEPPGPESSSRWLDDLLASPPPSGGGARRGAGAELKDTQSPST 715

NP_690895 309 TPDYAKSGCKVDMQP-FHSYGGPNESHFAPMGIMLNYDK-YDCGFVIPLEDPRHTDCNlWTempTMRDDFARQG–RFW- 383
BAG54589 549 CSEGLLGWSQKDLQSEFGITGDPQPSSFSPSSWCQGASQDYGLGGASPRGDPGLGERD-WT—SKYGQGAGEGSTREWA 624
NP_203754 716 CSEGLLGWSQKDLQSEFGITGDPQPSSFSPSSWCQGASQDYGLGGASPRGDPGLGERD-WT—SKYGQGAGEGSTREWA 791

NP_690895 384 -RYDLNVDHFRECIAR-HTHVYADGA—–RLMGTFV-FELVKGERWTLEICSYRDRQFRSALLARATPRLMHALG— 452
BAG54589 625 SRCGIGQEEMEASSSQDQSKVSAPGVLTAQDRVVGKPAQLGTQRSQEADVQDWEFRKRDSQGTYSSRDAELQDQEFGKRD 704
NP_203754 792 SRCGIGQEEMEASSSQDQSKVSAPGVLTAQDRVVGKPAQLGTQRSQEADVQDWEFRKRDSQGTYSSRDAELQDQEFGKRD 871

NP_690895 453 -YGTNFGRFIIAMDPRMNLSDF—–PVDVMRPAE–GRRPcvcQESRGAGPLMDELDFYFEKNWNEL——–ERR 516
BAG54589 705 SLGTYSSRDVSLGDWEFGKRDSLGAYASQDANEQGQDLGKRD—HHGRYSSQDADEQDWEFQKRDVSLGTYGSRAAEPQ 781
NP_203754 872 SLGTYSSRDVSLGDWEFGKRDSLGAYASQDANEQGQDLGKRD—HHGRYSSQDADEQDWEFQKRDVSLGTYGSRAAEPQ 948

NP_690895 517 AQEGGEPKTLTRPTELIEALTALGKGTAFSLTPQKGSCVPTTMARM[5]ADEWAVILEKMATSLALAAAKEGNPAEAF– 596
BAG54589 782 EQEFGKSAWIRDYSSGGSSRTLDAQDRSFGTRPLSSGFSPEEAQQQ DEEFEKKIPSVEDSLGEGSRDAGRPGERGSG 858
NP_203754 949 EQEFGKSAWIRDYSSGGSSRTLDAQDRSFGTRPLSSGFSPEEAQQQ DEEFEKKIPSVEDSLGEGSRDAGRPGERGSG 1025

NP_690895 597 —————-YRDMSSWTNDERSR———————————–AMQLITWKRLAIN– 623
BAG54589 859 GLFSPSTAHVPDGALGQRDQSSWQNSDASQEVGGHQERQQAGAQGPGSADLEDGEMGKRGWVGEFSLSVGPQREAAFSPG 938
NP_203754 1026 GLFSPSTAHVPDGALGQRDQSSWQNSDASQEVGGHQERQQAGAQGPGSADLEDGEMGKRGWVGEFSLSVGPQREAAFSPG 1105

NP_690895 624 ——-FGVKVSMRA–LGVRNGYRVSRAAI-PKGVMA[8]GGHVCPECHSvfqSAGERKMCTTLDLMFHQLFLL—- 694
BAG54589 939 QQDWSRDFCIEASERSYQFGIIGNDRVSGAGFSPSSKME GGHFVPPGKT—TAGSVDWTDQLGLRNLEVSSCVGSG 1012
NP_203754 1106 QQDWSRDFCIEASERSYQFGIIGNDRVSGAGFSPSSKME GGHFVPPGKT—TAGSVDWTDQLGLRNLEVSSCVGSG 1179

NP_690895 695 ——–STGDV-WLGALVIHDprSHVSKTMKGVNRGANGGVKYEEIRKVRQFMVK—-FPFGRTCPH 751
BAG54589 1013 GSSEARESAVGQMGWSGGLSLRD–MNLTGCLESGGSEEPGGIGVGEKDWTSDVNVKSKDFITSG—– 1075
NP_203754 1180 GSSEARESAVGQMGWSGGLSLRD–MNLTGCLESGGSEEPGGIGVGEKDWTSDVNVKSKDLAEVGEGGGH[482] 1729

The selkov decade ahead

What was left unsaid in the Grand Challenge submission of 2014

It was a particularly difficult and observationally driven exercise to enter the Grand Challenge as regards enteric immune insult.

What was not said in the small mission statement was that, in fact, the interior relatinships of clostridium botulinum and streptococci s are now defined. Consider the potent chemistry of the most deadly substance. How does the pathogen isolate that product?
Enter streptococci…..the grouping in view with a ruminant mutation uptake directly adjacent in genetic residue set *observed in ebov, agl 73453.1.

Much of the Kegg, toolbar prodctivity of modern molecular tools is shaped by observation of like (objects in residue).
The advantage of a tool that shapes active interior is much more forward thinking, and while a bit radical, in combonational end use, is far ahead of many of tools lacking the fine foci and interior mutation uptake as view available, not seen in Kegg and the quantifieid annotation.

Selkov toolbar assay of Hepatitis B residue describes current faulty orf

Fundamentally, the study of the Hepatitis virus of B typeform has allowed serious flaws to limit the investigational aspects of host presentation.

1. The nomenclature is muddled and indistinct, creating a confusing and unclear assessment.

2. The specific start codon of product is mis represented.

3. The mutation adventure as described via host pressure is not well founded.
With the assessment of viral insult to population, a rethinking of approach in the study to immune response seems vital and well crafted science, neglected by the simple addative approach that seems murky and indistinct. A new clarity has begun.
A complete ORF alignment is described.
Selkov toolbar is engaged.
The mutation adventure is observed as typical in viral species to describe the index case in species.

Execution of a blast search on the first orf residues produces:

Execution of a blast search on the last line of ofr residues produces a multivariant
draft of protein with observed internal non alignment.
Hence, rather variant product and/or conservation is premised.
Why has succinct and well defined component been neglected? The author suspects a lack of assay tools has allowed poorly defined or mis representational protein assignment.
Clearly, the variant protein residues observed internal to the orf with similar nomenclature weakens adequate identifiers towards this residue set.
Here, the observational quality of the Selkov toolbar is fully engaged and a definition of precursor uptake as conserved mutation fully eleucedated to define the pathogen observed in residue.

Unusual set with poplar interaction described as unknown?
WP_019422196 1 MTEKKEIIEIGWNFDNSYACLPE LFFTKLDPTPVRSPKLMILNDSLAPSLGLNVEALQSTDGVAVFAGN QVPE 73 WP_016416158 1 MASD-ETLEV-YQGDKYVGRLHD AQPLRFEYDPAWQER——HLSPSLPLS-QQVHVGDEVLAYFEN LLPE 64 XP_007288702 1 MLSNPLHRYSAYDALPSSSMLPN[12]LQTLADGSQYALQQMHQQHQQHHQQHQHVEVSHVPRNDHEVQRSQN[4]QHPY 89 WP_019422196 74 GALP————–LAQAYAGHQFGHFTMLGDGRA[5]QITPLGERVDIQLKGSGRTPYSRRgdGRAALGPMLREY 141 WP_016416158 65 GDLRHHLELCHHTTTVFGLLKAIGGDTASSFTLLPPGES PAPPHYRPISWEALEEHLRHRER——–GPLLSQQ 133 XP_007288702 90 SAAGQGRGLSSASSGPIRRRISRACDQCNQLRTKCDGQS —PCAHCVEFGLGCEYIRERKKR–GKASRKDLAQQ- 160 WP_019422196 142 IISEAMHSLGIATTRSLAVVTTGESVIRETEQPGAILTRVAASHLRVGTFQYVSNWGNVQDLRTLAD-YTLQRHFPKVDA 220 WP_016416158 134 SEEARISLAGAQDKLLLMVLEDGSPAIPEGSAPSSHILKPDIQGLRGVWGSAINETFCMQLAAELGL-EVAGASYQP— 209 XP_007288702 161 –AAATAASGGQEAPSGGGQGHGQSSDEPASPPESRHEHESSSATPTQQETGVLRRSQASRSLSLCLgRTASELDPASGR 238 WP_019422196 221 DENRFLVLLKEVIKLQAVLISKWQLVGFIHGVMNTDNMALSGETIDYGPCAFMDTYDPETVFSSIDMDGRYAYGNQPNIA 300 WP_016416158 210 ————-ETRACLVRRYDRVPDEQGGLRRLHQ——LDFCQLAGTPSLIKYESDGGPGLARCRELLQQVGTP 270 XP_007288702 239 DATQGRLQRAGSLESLTGLVPHMASRADPDQIESPASLTMSSYSSLHGYRPALESHLLRGSTGSGGGQSSFAAG-QGSLP 317 WP_019422196 301 AWNLARFAEALLPLLHDNELQAVQLAEDAISEFFELYHRNWLEGMRGKLGIFNEEEQ-DESLMDGLLSMMQKYRADYTNT 379 WP_016416158 271 AKDLQRLIGWF———————FFNLLIGNNDSHAKNLAILYTDEGP-RLAPFYDLMSTTLYSGFSRRFA 328 XP_007288702 318 GFDLSYAIQAPSPTTHYPAPSTTPGPFHLGDSPISGFPMASEAASPGWMSLPSPSNQyRQHVPSPSFSTTLRLPVLQPLI 397 WP_019422196 380 FRALTFEKSENTALFGSTEYAEWHELWQARLTRQQESKASSQQL-MRSSNPALIPRNHRVEEALEAAVKQGDYSVmerLL 458 WP_016416158 329 FRVAEEDRP——GNIERSHLESL–ARAMRFQPRYFLRQGLELTEQMPAATDSTLATLATLGAEAHQGTEQT—L- 396 XP_007288702 398 PYLGNIIPVSLACDLLDLYFASSSSALMHPTSPYVLGYVFRKQSILHRTKPR–PCTPALLASMLWVVAQTSDAS—FL 472 WP_019422196 459 DVLSSPYAHSIEQVEYSTLPALSPRSYRTFCGT- 491 WP_016416158 397 ———-LERLQQRLMSNCRKLTVRWAVGGS 420 XP_007288702 473 TAPPSSRGRVCQRLLELTVGLLKPL-IHGSAGDE[488] 993

Here the isolucine selkov is descriptive of true mutation, adventure.

Internal to the rather wide oraganism based vis is the hidden internal structure ,

shared and conserved in the viral insult .
I observe transcriptional regulators, hence the sequence data is premised corrupt.
There may be zero overlap as I first surmised.
The typical bacteriodies dna repair, Bartonella, paenicibacilli, Campobacter j, thioalkalivibro,
(inserts glutamine and hence conserved mutant),
zone of mammal pteropus slecto residue?
and the isolucine selkov view below: elegant really in reducing interior pattern to view.
YP_008014455 1 [1]—–GGAPSGSLGVLLPHLELASLLDQCVDRLVRVTSRAHDVQDEEQRVDLMVGLTKAAEALRASER–CDHEPAE 71 WP_007035058 1 [6]AGNGKGGAPPMPLGVLMPSLELASWLDRYVDRIVRADPKGDDALASEQRVDLMVGLAKAAEALRASAR–CDPESAE 81 YP_001755765 1 MDSFRPHLAKVAGGLALDRAEARAAFDDLLSGEVTPVQAGAFLTALKVRGESVEEIVGAAEAMRARMTRvAAPENAV 77 WP_004951341 1 ————————————MPDVHVPIPAETRDRLTAAAAAEGLSLRAHLMR—–LAG 36 WP_019972841 1 [5]ESRRRIEAAIVEIGRRHLVTEGAAGLSLRAVARELGMVSSAIYRYVADRDDLLTLLVVDAYSELADAVD—–QAA 77 YP_008014455 72 RLLRSALDLMRGVDLNRFALSDR—————————- 94 WP_007035058 82 YELRSALELMRGIDLDRFALFAH—————————- 104 YP_001755765 78 DVVGTGGDHSGSVNVSTLAAIVVaACGVPVAKHGNRAATSRSGAADVLAAL[217] 345 WP_004951341 37 DSARPARDGTRA-DRVRQALHAWnGYDPDPEEEARLDAELDRRIAEAAATG 86 WP_019972841 78 AGLSVESDWRTRLSEMAYAVRRW-AIDQPARWALLYGSPVPGYHAPAERTV[101] 228